Protein Info for CSW01_12985 in Vibrio cholerae E7946 ATCC 55056

Annotation: ElaA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF13527: Acetyltransf_9" amino acids 12 to 129 (118 residues), 28.1 bits, see alignment E=3.7e-10 PF00583: Acetyltransf_1" amino acids 21 to 129 (109 residues), 46.5 bits, see alignment E=8.6e-16 PF13673: Acetyltransf_10" amino acids 46 to 147 (102 residues), 65.4 bits, see alignment E=1e-21 PF13508: Acetyltransf_7" amino acids 49 to 130 (82 residues), 40.9 bits, see alignment E=4.6e-14

Best Hits

Swiss-Prot: 45% identical to ELAA_ECOLI: Protein ElaA (elaA) from Escherichia coli (strain K12)

KEGG orthology group: K02348, ElaA protein (inferred from 99% identity to vco:VC0395_A2142)

Predicted SEED Role

"ElaA protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>CSW01_12985 ElaA protein (Vibrio cholerae E7946 ATCC 55056)
MINWQCIPFCQLTTQQLYELLKLRVDVFVVEQTCPYPELDNKDTLNEVHHLLGYQDGELV
ACARLLPAGVSYPSVSLGRVATKASARGNGLGHQLLQTALEQCQNLWPQQSIEIGAQEHL
REFYARYGFVATSEIYLEDGIPHIDMKRA