Protein Info for CSW01_12955 in Vibrio cholerae E7946 ATCC 55056

Annotation: sulfate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF00009: GTP_EFTU" amino acids 25 to 226 (202 residues), 159.6 bits, see alignment E=1.4e-50 TIGR02034: sulfate adenylyltransferase, large subunit" amino acids 27 to 433 (407 residues), 649.3 bits, see alignment E=2.5e-199 TIGR00231: small GTP-binding protein domain" amino acids 33 to 213 (181 residues), 50.6 bits, see alignment E=1.9e-17 PF01926: MMR_HSR1" amino acids 86 to 168 (83 residues), 24.2 bits, see alignment E=6.3e-09 PF03144: GTP_EFTU_D2" amino acids 264 to 323 (60 residues), 33.8 bits, see alignment E=7.5e-12 PF22594: GTP-eEF1A_C" amino acids 337 to 433 (97 residues), 70.1 bits, see alignment E=3.6e-23

Best Hits

Swiss-Prot: 100% identical to CYSN_VIBCH: Sulfate adenylyltransferase subunit 1 (cysN) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00956, sulfate adenylyltransferase subunit 1 [EC: 2.7.7.4] (inferred from 100% identity to vco:VC0395_A2136)

MetaCyc: 66% identical to sulfate adenylyltransferase subunit 1 (Escherichia coli K-12 substr. MG1655)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>CSW01_12955 sulfate adenylyltransferase (Vibrio cholerae E7946 ATCC 55056)
MNNAVKEQLAELGIEGYLNQHQHKSLLRFLTCGSVDDGKSTLIGRLLHDSKQIYEDQLAA
VHNDSQRVGTTGSRPDLALLVDGLQAEREQGITIDVAYRYFSTQKRKFIIADTPGHEQYT
RNMATGASTCDLAVILIDARKGVLDQTRRHSFISNLLGLKHFIVAVNKMDLVDYSQDRFE
QIRAEYLEFSKHLQGETEIQIIPLSALEGDNVVEKSRLMDWYQGPSLLELLEYVDIDRDK
SSGAFRFPVQYVNRPNLDFRGFAGTIASGVVKVGDKIKALPSGKTSTVTRIVTFDGDLPQ
AQAGLAVTLTLADEIDISRGDLIVLESAQVDSTNHLLADVVWMTEQPLQVGRDYDIKIAG
KKTVGQVKAVRHQYDINNLSTYHAESLPLNGIGLCEWTFTQTVALDKYLDCADTGGFIII
DRLTNVTVGAGLVRDSLQNITGQTESFSAFELELNALVRKHFPHWQAIDLSRLGKA