Protein Info for CSW01_12950 in Vibrio cholerae E7946 ATCC 55056

Annotation: adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 21 to 205 (185 residues), 276 bits, E=6.7e-87
• PF01583: APS_kinase
  • amino acids 38 to 192 (155 residues), 238.3 bits, E=3.6e-75
• PF13671: AAA_33
  • amino acids 41 to 154 (114 residues), 33.7 bits, E=4.2e-12

Best Hits

Swiss-Prot: 100% identical to CYSC_VIBCH: Adenylyl-sulfate kinase (cysC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 100% identity to vch:VC2558)

MetaCyc: 67% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (5/10 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Protein Sequence (215 amino acids)

>CSW01_12950 adenylyl-sulfate kinase (Vibrio cholerae E7946 ATCC 55056)
MSKQADSLGFEQDAKPENVVWHRHAVDKAQRATLKQQRPAVLWFTGLSGAGKSTVAGALE
NRLAALGYHTYLLDGDNVRHGLCSDLGFSEQDRRENIRRIGELAKLMSDAGLIVLTAFIS
PHRAERQMVRDLLPNGEFLEVYVNTSLDVCEARDPKGLYKKARAGEIRQFTGIDSAYEAP
LNPDIDLPAGEKSVDELVAQCLQALAERHIIQRWV