Protein Info for CSW01_12950 in Vibrio cholerae E7946 ATCC 55056

Annotation: adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 103 to 119 (17 residues), see Phobius details TIGR00455: adenylyl-sulfate kinase" amino acids 21 to 205 (185 residues), 276 bits, see alignment E=6.7e-87 PF01583: APS_kinase" amino acids 39 to 186 (148 residues), 231.7 bits, see alignment E=3.9e-73 PF13671: AAA_33" amino acids 41 to 154 (114 residues), 32.9 bits, see alignment E=7.6e-12

Best Hits

Swiss-Prot: 100% identical to CYSC_VIBCH: Adenylyl-sulfate kinase (cysC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 100% identity to vch:VC2558)

MetaCyc: 67% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>CSW01_12950 adenylyl-sulfate kinase (Vibrio cholerae E7946 ATCC 55056)
MSKQADSLGFEQDAKPENVVWHRHAVDKAQRATLKQQRPAVLWFTGLSGAGKSTVAGALE
NRLAALGYHTYLLDGDNVRHGLCSDLGFSEQDRRENIRRIGELAKLMSDAGLIVLTAFIS
PHRAERQMVRDLLPNGEFLEVYVNTSLDVCEARDPKGLYKKARAGEIRQFTGIDSAYEAP
LNPDIDLPAGEKSVDELVAQCLQALAERHIIQRWV