Protein Info for CSW01_12910 in Vibrio cholerae E7946 ATCC 55056

Annotation: peptide-methionine (S)-S-oxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 44 to 197 (154 residues), 220.7 bits, see alignment E=5.6e-70 PF01625: PMSR" amino acids 44 to 198 (155 residues), 200.3 bits, see alignment E=1.2e-63

Best Hits

Swiss-Prot: 100% identical to MSRA_VIBC3: Peptide methionine sulfoxide reductase MsrA (msrA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 100% identity to vcm:VCM66_2470)

MetaCyc: 56% identical to methionine sulfoxide reductase A (Escherichia coli K-12 substr. MG1655)
L-methionine (S)-S-oxide reductase. [EC: 1.8.4.13]; Peptide-methionine (S)-S-oxide reductase. [EC: 1.8.4.13, 1.8.4.11]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11 or 1.8.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>CSW01_12910 peptide-methionine (S)-S-oxide reductase (Vibrio cholerae E7946 ATCC 55056)
MLDKQTMVTAHNALPGRTTAMSIDDTHFVNGSSLTAAPQSGQQQILIGMGCFWGAERLFW
QLDGVISTSVGYSGGFTPNPTYEEVCSGKTGHTEVVRVIFDPERLPLTELLRAFWERHDP
TQGMRQGNDRGTQYRSAIYTFSEDQREIAEASKAAYQALLTAQHRPSITTEILPAGAYYF
AETYHQQYLAKNPNGYCGLGGTGVCFPPHSTL