Protein Info for CSW01_12875 in Vibrio cholerae E7946 ATCC 55056

Annotation: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01081: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase" amino acids 2 to 449 (448 residues), 912.4 bits, see alignment E=2.8e-279 PF01225: Mur_ligase" amino acids 2 to 101 (100 residues), 78.8 bits, see alignment E=5e-26 PF08245: Mur_ligase_M" amino acids 108 to 291 (184 residues), 79.7 bits, see alignment E=4.4e-26 PF02875: Mur_ligase_C" amino acids 313 to 435 (123 residues), 69.3 bits, see alignment E=9e-23

Best Hits

Swiss-Prot: 70% identical to MPL_ECOLI: UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptandioate ligase (mpl) from Escherichia coli (strain K12)

KEGG orthology group: K02558, UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC: 6.3.2.-] (inferred from 100% identity to vcm:VCM66_2463)

MetaCyc: 70% identical to UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptanedioate ligase (Escherichia coli K-12 substr. MG1655)
RXN0-2361 [EC: 6.3.2.45]; 6.3.2.45 [EC: 6.3.2.45]

Predicted SEED Role

"UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-)" (EC 6.3.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.-

Use Curated BLAST to search for 6.3.2.- or 6.3.2.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>CSW01_12875 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase (Vibrio cholerae E7946 ATCC 55056)
MHIHILGICGTFMGGVAMLARQLGHKVTGSDANVYPPMSTMLEAQGIEIIEGFDPVQLEP
KPDLVVIGNAMSRGNPCVEYVLNHNLRYTSGPQWLQDFLLHDRWVIAVSGTHGKTTTSSM
IAWVLEHCGYQPGFLVGGVLGNFGISARLGESMFFVVEADEYDSAFFDKRSKFVHYHPRT
LVMNNLEFDHADIFDNLEAIKRQFHHLVRTVPGNGRILAPKQDEALADVLQRGCWSETEF
SGEQGEWQAEKITADGSQFHVLLKGERVGQVNWSLVGDHNVSNALMAIAAARHVGVAPEL
ACEALGLFVNTKRRLELKGEINGVTVYDDFAHHPTAIELTLGGLRNKVGDKKIIAVLEPR
SATMKLGVHKETLAASLHSADSVYLYQPSNIPWSVEEVAKQCQQPAQVSANMDEFVAMIA
KEAQAGDQILVMSNGGFEGIHGKLLAALQQK