Protein Info for CSW01_12855 in Vibrio cholerae E7946 ATCC 55056

Annotation: thiamine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR01277: thiamine ABC transporter, ATP-binding protein" amino acids 8 to 220 (213 residues), 396.2 bits, see alignment E=1.7e-123 PF00005: ABC_tran" amino acids 24 to 163 (140 residues), 122.8 bits, see alignment E=1.7e-39

Best Hits

Swiss-Prot: 100% identical to THIQ_VIBCH: Thiamine import ATP-binding protein ThiQ (thiQ) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02062, thiamine transport system ATP-binding protein (inferred from 100% identity to vcm:VCM66_2458)

MetaCyc: 53% identical to thiamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-32-RXN [EC: 7.6.2.15]

Predicted SEED Role

"Thiamin ABC transporter, ATPase component" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>CSW01_12855 thiamine ABC transporter ATP-binding protein (Vibrio cholerae E7946 ATCC 55056)
MLMRKSMLALDKVRYEYEHEWFEFDLNVADGDIVALMGPSGAGKSTLLSLVAGFIEPVSG
SIKVNDQSVLGLAPYQRPFSMLFQEHNLFAHLTVRENIGLGLHPGLKLNAEQKQQVVDAA
QQVGIADYLDRLPEQLSGGQRQRVALARCFVQPNPIWLLDEPFSALDPLLREEMLALVKQ
LASERQRTVVMVTHHLSDARAIASQIAFLSQGKVKVVSDCQAVTAQHPHPELAQFVAAAL
NEPK