Protein Info for CSW01_12810 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR04406: LPS export ABC transporter ATP-binding protein" amino acids 4 to 241 (238 residues), 418.8 bits, see alignment E=2.8e-130 PF00005: ABC_tran" amino acids 20 to 166 (147 residues), 124.5 bits, see alignment E=4.8e-40 PF12399: BCA_ABC_TP_C" amino acids 214 to 239 (26 residues), 39.9 bits, see alignment (E = 2.4e-14)

Best Hits

Swiss-Prot: 75% identical to LPTB_ECO57: Lipopolysaccharide export system ATP-binding protein LptB (lptB) from Escherichia coli O157:H7

KEGG orthology group: K06861, lipopolysaccharide export system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to vch:VC2528)

MetaCyc: 76% identical to LPS export ABC transporter ATP-binding protein (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"Lipopolysaccharide ABC transporter, ATP-binding protein LptB" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>CSW01_12810 ABC transporter ATP-binding protein (Vibrio cholerae E7946 ATCC 55056)
MAILKAQHLAKSYKKRKVVSDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGTI
TIDDNDISILPMHSRSRMGIGYLPQEASIFRKLSVEDNIMAVLQTREELTHEERQDKLED
LLEEFHIQHIRKSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKII
EHLRDRGLGVLITDHNVRETLDVCEKAYIVSQGRLIAEGTPQDVLNNEQVKQVYLGEQFR
L