Protein Info for CSW01_12775 in Vibrio cholerae E7946 ATCC 55056

Annotation: phospholipid ABC transporter ATP-binding protein MlaF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 23 to 170 (148 residues), 104.7 bits, E=3.2e-34

Best Hits

Swiss-Prot: 72% identical to MLAF_ECO57: Intermembrane phospholipid transport system ATP-binding protein MlaF (mlaF) from Escherichia coli O157:H7

KEGG orthology group: K02065, putative ABC transport system ATP-binding protein (inferred from 100% identity to vcj:VCD_001838)

Predicted SEED Role

"Uncharacterized ABC transporter, ATP-binding protein YrbF"

Protein Sequence (267 amino acids)

>CSW01_12775 phospholipid ABC transporter ATP-binding protein MlaF (Vibrio cholerae E7946 ATCC 55056)
MSQSDLVTIKNLRFSRSQRVIFDDIDLHVPKGKVTAIMGPSGIGKTTLLRLIGGQLLPEQ
GEIWFDGENIPTLSRRKLYRARKKMSMLFQSGALFTDLNVFDNVAYPLREHTELDEAMIK
TLVLLKLEAVGLRGAAYLMPSELSGGMARRAALARAIALDPELIMYDEPFVGQDPITMGV
LVELIRNLNRALGVTSVVVSHDVPEVMSIADWVYLLADGKVIAQGSPQALRDNPDPRVQQ
FLCGDADGPVPFRFPAQPIEQELFSAK