Protein Info for CSW01_12770 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 51 to 76 (26 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 6 to 256 (251 residues), 328.7 bits, see alignment E=1.5e-102 PF02405: MlaE" amino acids 43 to 254 (212 residues), 252.1 bits, see alignment E=2.1e-79

Best Hits

Swiss-Prot: 74% identical to MLAE_HAEIN: Intermembrane phospholipid transport system permease protein MlaE (mlaE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to vco:VC0395_A2101)

Predicted SEED Role

"Uncharacterized ABC transporter, permease component YrbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>CSW01_12770 ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MRWVSSVGQRTLAVSETFGRASLMLFGALVGRPQPIRHFPLLVRQLYSIGVQSLAIIIVS
GLFIGMVLSLQGYVILVDYGAETSLGQMVALSLLRELGPVVTALLFAGRAGSALTAEIGL
MKATEQLSSLEMMAVDPLKRVIAPRFWAGVISMPLLAMIFMAVGIWGGQLVGVDWKGIDH
GSFWSAMQASVELGQDIGNSTIKCVVFAFTVTWIALFNGYDAIPTSEGISRATTRTVVHS
SLAVLGLDFVLTALMFGN