Protein Info for CSW01_12725 in Vibrio cholerae E7946 ATCC 55056
Annotation: aspartate carbamoyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to PYRB_VIBCH: Aspartate carbamoyltransferase (pyrB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 100% identity to vco:VC0395_A2092)MetaCyc: 71% identical to aspartate carbamoyltransferase catalytic subunit (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
- superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
- UMP biosynthesis I (6/6 steps found)
- UMP biosynthesis II (6/6 steps found)
- UMP biosynthesis III (5/6 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.1.3.2
Use Curated BLAST to search for 2.1.3.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (309 amino acids)
>CSW01_12725 aspartate carbamoyltransferase (Vibrio cholerae E7946 ATCC 55056) MANSLYQKHIISIAELSRAELELIVKTAGQLKAQPNPELIKHKVVASCFFEPSTRTRLSF ETAIQRIGGSVIGFDNGGNTSLAKKGETLADSVRVISSYVDAFVMRHPQEGAARLASEFS NGVPVINAGDGSNQHPSQTLLDLYSIFETQGRLDNLDVAFVGDLKYGRTVHSLAQALAKF DNNRFYFVAPEALAMPDYICEELDEAGVKYQVFSDMESVIPELDILYMTRVQKERFDESE YAHIKSAYILTAAHLSDARSNLKVLHPLPRVDEITTDVDKTPHAYYFEQVENGVYAREAL LALVLNESL