Protein Info for CSW01_12720 in Vibrio cholerae E7946 ATCC 55056

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 8 to 148 (141 residues), 159.5 bits, E=6.6e-51
• TIGR00658: ornithine carbamoyltransferase
  • amino acids 8 to 332 (325 residues), 442.6 bits, E=3.4e-137
• PF00185: OTCace
  • amino acids 157 to 330 (174 residues), 187.3 bits, E=1.9e-59

Best Hits

Swiss-Prot: 100% identical to OTC_VIBCH: Ornithine carbamoyltransferase (argF) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 99% identity to vco:VC0395_A2091)

MetaCyc: 68% identical to ornithine carbamoyltransferase ArgI (Escherichia coli K-12 substr. MG1655)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (5/5 steps found)
• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (3/6 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Protein Sequence (334 amino acids)

>CSW01_12720 ornithine carbamoyltransferase (Vibrio cholerae E7946 ATCC 55056)
MAFNLRNRNFLKLLDFTPKEIHFLLDLSAELKRAKYAGTEQKTLQGKNIALIFEKSSTRT
RCAFEVAAFDQGAQVSYIGPSGSQIGHKESMKDTARVLGRMYDGIQYRGFGQEIVEVLGQ
YAGVPVWNGLTDEFHPTQILADLLTMQEYGRSKQLHEMKFAYLGDARNNMGNSLMVGAAK
MGMDIRLVAPKAYWPNDALVATCQEIAKQTGAKITLTEEVQEGVKGCDFLYTDVWVSMGE
AADAWDERVALMKPYQVNMDVIKATGNPQVKFMHCLPAFHDDQTKVGQEIAAKYGMQGLE
VTEEVFESEYSIVFDEAENRLHTIKAVMVATLGQ