Protein Info for CSW01_12695 in Vibrio cholerae E7946 ATCC 55056

Annotation: lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 38 to 325 (288 residues), 80.1 bits, E=1.2e-26
• PF02826: 2-Hacid_dh_C
  • amino acids 114 to 294 (181 residues), 190.1 bits, E=2.3e-60

Best Hits

Swiss-Prot: 52% identical to Y1556_HAEIN: Putative 2-hydroxyacid dehydrogenase HI_1556 (HI_1556) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00018, glycerate dehydrogenase [EC: 1.1.1.29] (inferred from 100% identity to vch:VC2504)

Predicted SEED Role

No annotation

MetaCyc Pathways

• photorespiration II (8/10 steps found)
• photorespiration I (7/9 steps found)
• photorespiration III (7/9 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.29

Protein Sequence (325 amino acids)

>CSW01_12695 lactate dehydrogenase (Vibrio cholerae E7946 ATCC 55056)
MSLPTTSLPTVVFLDRATIPRHISLPALPFEHHWLEYDACEPQQVVERLLAADIVITNKV
VLTREMLIQLPKLKLIAISATGTNNVDLPACRDLNIAVCNVQGYATRSVPEHVVAMMFAL
RRNLIGYHNDIAAGEWQRHKQFCFFTHPIGDIAGSTMGIIGSGALGQATANLARALGMHV
LLAERKGQVECRDGYTSFEQVLAQSDVLSLHCPLTDETRNIISEAELAQMNPNALLINTG
RGGLVDEQALVDALKRRQIAGAGVDVFSAEPADMDNPLIANRDLPNLLLTPHVAWGSDSS
IQQLATILIDNISAFMRGEAKNRVV