Protein Info for CSW01_12670 in Vibrio cholerae E7946 ATCC 55056

Annotation: LPS export ABC transporter permease LptG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 59 (17 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 4 to 354 (351 residues), 436.6 bits, see alignment E=2.5e-135 PF03739: LptF_LptG" amino acids 7 to 352 (346 residues), 265.8 bits, see alignment E=3e-83

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 100% identity to vcm:VCM66_2421)

Predicted SEED Role

"FIG000906: Predicted Permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>CSW01_12670 LPS export ABC transporter permease LptG (Vibrio cholerae E7946 ATCC 55056)
MFKILDWYIGRTIVATTALVLVTFVGLSGIIKYVEQLRKVGEGSYDLLQALLFVVLSIPR
DVEMFFPMAALLGALIGLGALASSSELVVMQAAGFSKLDIGLSVLKTAIPLMIIVTLLGE
WGAPQAQKMARDMRAFATSGGAIMSVRTGVWARDANDFIFIAKVENEHLYGLNLWRFDEN
KKLSTVIFSEQVDYVANNEWLMKDAVLTRLVNDIEISKESLPEYRWRTSLAPDKLAVVTV
KPEELSLTGLSDYVHYLKASEQDSSRYELALWRKVTQPISIAVMMLMALSFIFGPLRSVT
MGARILSGVIAGFSFYISSEFFGPLSLVYGLPPLFGALAPSLVFLAIALGLLGRKL