Protein Info for CSW01_12655 in Vibrio cholerae E7946 ATCC 55056

Annotation: HD-GYP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 PF11871: DUF3391" amino acids 4 to 136 (133 residues), 126.7 bits, see alignment E=1.4e-40 TIGR00277: HDIG domain" amino acids 166 to 259 (94 residues), 31.6 bits, see alignment E=5.8e-12 PF01966: HD" amino acids 169 to 290 (122 residues), 66 bits, see alignment E=5.9e-22 PF13487: HD_5" amino acids 172 to 316 (145 residues), 93 bits, see alignment E=2.8e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A2078)

Predicted SEED Role

"FIG00919795: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>CSW01_12655 HD-GYP domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MASIKITVDRLQPGLYIRLPVKWNEHPFLFNSFKIKSQEQIQLIKHLGIQHVFLNPGLSD
SQPLPPSVEEATPEEALPPVDSEAEKLWQEKQTRIEKLNEYRRRVQTCEKEFERSLARMR
AVVNKIRNRPLDAVGEAIILVDDIVDKLLSDDNVTLHLMNSKSEFEDIYFHSLNVSVIAM
MIGKARGLPAERIKELAFAALFHDIGKVRVPTAIVRKKTPLTEPEENYLRLHTKYGIELA
DNIETFPESAKRVIEQHHELRDGSGYPLGLKGDDIDELAQIVAVANAFDNLCHPNIPSEQ
KIPYVALSHLFKNCKHIYNAENLGILVKFMGVFPPGTVVQLSNDMVGLVISVNASSLLYP
NVLIYDPSVPRSQAPIIDLADRDLKIVNAILPNKLPDKVRDYLNPRSRISYFFDSEE