Protein Info for CSW01_12610 in Vibrio cholerae E7946 ATCC 55056

Annotation: 3-isopropylmalate dehydratase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 TIGR00171: 3-isopropylmalate dehydratase, small subunit" amino acids 1 to 188 (188 residues), 319.9 bits, see alignment E=2.8e-100 PF00694: Aconitase_C" amino acids 1 to 125 (125 residues), 139.3 bits, see alignment E=1.4e-44 PF27512: LeuD" amino acids 129 to 165 (37 residues), 46.9 bits, see alignment 2.8e-16 PF27434: LeuD_C" amino acids 178 to 194 (17 residues), 29.5 bits, see alignment (E = 5.9e-11)

Best Hits

Swiss-Prot: 100% identical to LEUD_VIBCM: 3-isopropylmalate dehydratase small subunit (leuD) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K01704, 3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC: 4.2.1.33 4.2.1.35] (inferred from 100% identity to vch:VC2493)

MetaCyc: 72% identical to 3-isopropylmalate dehydratase subunit LeuD (Escherichia coli K-12 substr. MG1655)
3-isopropylmalate dehydratase. [EC: 4.2.1.33]

Predicted SEED Role

"3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 4.2.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.33, 4.2.1.35

Use Curated BLAST to search for 4.2.1.33 or 4.2.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>CSW01_12610 3-isopropylmalate dehydratase small subunit (Vibrio cholerae E7946 ATCC 55056)
MSGFQQHTGLVVPLDAANVDTDAIIPKQFLQKVNRTGFGKHLFHDWRFLDDAGEKANPEF
VMNQPRYQDASILLARENFGCGSSREHAPWALADYGIRVMIAPSFADIFYGNSINNQMVP
VRLTEQEVDELFTYVHDTEGATITVDLEALSVTANGKTYHFEIDDFRRHCLLNGLDNIGL
TLQHEAKIAEYEAKIPSFLK