Protein Info for CSW01_12265 in Vibrio cholerae E7946 ATCC 55056

Annotation: carboxylating nicotinate-nucleotide diphosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)" amino acids 28 to 294 (267 residues), 310.5 bits, see alignment E=4.4e-97 PF02749: QRPTase_N" amino acids 43 to 127 (85 residues), 67 bits, see alignment E=1.4e-22 PF01729: QRPTase_C" amino acids 130 to 293 (164 residues), 200.8 bits, see alignment E=1.4e-63

Best Hits

Swiss-Prot: 62% identical to NADC_SALTY: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 100% identity to vch:VC2422)

MetaCyc: 62% identical to quinolinate phosphoribosyltransferase (decarboxylating) (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide diphosphorylase (carboxylating). [EC: 2.4.2.19]

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>CSW01_12265 carboxylating nicotinate-nucleotide diphosphorylase (Vibrio cholerae E7946 ATCC 55056)
MKETHNSQDRLAYLKQQLPADITRSVIDTLKEDLGGTLDPAADITASLIPADRISTATII
TREAGVFCGQLWADEVFKQLGGQVSIEWHVQDGDTLTPNQTLCTLTGPARILLTGERNAM
NFIQTLSGCATATARYVQELKGTQCRLLDTRKTIPGLRSALKYAVACGGGYNHRIGVFDA
YLIKENHIIACGGIRQAISTAKQLNPGKPVEVETETLAELEEAISAGADIIMLDNFSLEM
MREAVKINAGRAALENSGNITLDNLKECAETGVDYISVGALTKHLKALDLSMRFKS