Protein Info for CSW01_12170 in Vibrio cholerae E7946 ATCC 55056

Annotation: UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21799: MurD-like_N
  • amino acids 13 to 101 (89 residues), 107.9 bits, E=3.9e-35
• TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • amino acids 13 to 441 (429 residues), 490.8 bits, E=2.3e-151
• PF08245: Mur_ligase_M
  • amino acids 117 to 286 (170 residues), 105.1 bits, E=7.6e-34
• PF02875: Mur_ligase_C
  • amino acids 309 to 376 (68 residues), 34.5 bits, E=3.2e-12

Best Hits

Swiss-Prot: 100% identical to MURD_VIBCH: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to vcj:VCD_001950)

MetaCyc: 52% identical to UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase. [EC: 6.3.2.9]

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Protein Sequence (444 amino acids)

>CSW01_12170 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Vibrio cholerae E7946 ATCC 55056)
MSISMDRWQGIQHVVVVGLGITGLSVVNYLRKYHPSVTVQVIDTREAPPGQEQLSSDVAL
HRSGWNLEWLLNADLVVTNPGIALATPEIQQVLAAGIPVVGDIELFAWHVDTPVIAITGS
NGKSTVTDLSGVLANAAGVKAAVGGNIGVPALDLISPDVELYVLELSSFQLETTSSLKLK
AAAFLNLSEDHMDRYQGMEDYRQAKLRIFDHAETAVVNADDTQTFPDHAAHLQVVTFGVE
QAAQFSLAQHQGREYLFARDEAVMACAELSLVGRHNVANVLTVLALLDSAGVNFRLALDA
LKSYTGLTHRCQVVADNHGIKWVNDSKATNVASTLAALSGLKIEGQLYLLVGGVGKGADF
TPLAPVLATLPVQLCCFGVDGHQFMPLHPSARFYDSMESIIRSIRPQLKSGDMVLLSPAC
ASFDQFKNFMARGDIFAQLARQYA