Protein Info for CSW01_12155 in Vibrio cholerae E7946 ATCC 55056

Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 25 to 38 (14 residues), see Phobius details PF01225: Mur_ligase" amino acids 25 to 122 (98 residues), 114.4 bits, see alignment E=3.8e-37 TIGR01082: UDP-N-acetylmuramate--L-alanine ligase" amino acids 25 to 473 (449 residues), 635.5 bits, see alignment E=2.9e-195 PF08245: Mur_ligase_M" amino acids 127 to 307 (181 residues), 101.8 bits, see alignment E=7.6e-33 PF02875: Mur_ligase_C" amino acids 329 to 464 (136 residues), 62.6 bits, see alignment E=1.1e-20

Best Hits

Swiss-Prot: 100% identical to MURC_VIBCH: UDP-N-acetylmuramate--L-alanine ligase (murC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to vco:VC0395_A1978)

MetaCyc: 73% identical to UDP-N-acetylmuramate--L-alanine ligase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramate--L-alanine ligase. [EC: 6.3.2.8]

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>CSW01_12155 UDP-N-acetylmuramate--L-alanine ligase (Vibrio cholerae E7946 ATCC 55056)
MTIKHTQDLAQIRAMVPEMRRVKAIHFIGIGGAGMSGIAEVLLNEGYQISGSDLAANAVT
DRLADKGATIFIGHEAHNVAHASVVVVSTAINEQNPEIQAAREKRIPIVRRAEMLAELMR
FRHGIAVAGTHGKTTTTALVTQIYSEAGLDPTFVNGGLVKSAGTNARLGSSRILIAEADE
SDASFLHLQPMVTIVTNIEADHMDTYGGDFENLKQTFIDFLHNLPFYGQAILCIDDPVIR
ELIPRVSRQVITYGFSEDADVRIENYRQNGQQGQFTVVRKGKANLDITLNIPGRHNALNA
AAAIAVATEDDIRDEAILRAMANTQGTGRRFDHLGEFETGNGVAMLVDDYGHHPTEVDVT
IKAARNGWAEKRLVMIFQPHRYTRTRDLYDDFANVLEQVDVLIMLDVYAAGEKPIAGADG
RSLCRTIRSRGKIDPIFVPDSQTLPSVLANILQDGDLVLTQGAGDVGKVARHLAALELNI
GRMQQI