Protein Info for CSW01_12125 in Vibrio cholerae E7946 ATCC 55056

Annotation: protein translocase subunit SecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 903 PF07517: SecA_DEAD" amino acids 7 to 403 (397 residues), 440.1 bits, see alignment E=9.4e-136 TIGR00963: preprotein translocase, SecA subunit" amino acids 28 to 817 (790 residues), 1135.1 bits, see alignment E=0 PF01043: SecA_PP_bind" amino acids 232 to 359 (128 residues), 132.5 bits, see alignment E=2.5e-42 PF21090: P-loop_SecA" amino acids 418 to 612 (195 residues), 306.4 bits, see alignment E=2.4e-95 PF07516: SecA_SW" amino acids 617 to 829 (213 residues), 241.9 bits, see alignment E=1.7e-75 PF02810: SEC-C" amino acids 883 to 900 (18 residues), 40 bits, see alignment (E = 6.9e-14)

Best Hits

Swiss-Prot: 79% identical to SECA_ALIFM: Protein translocase subunit SecA (secA) from Aliivibrio fischeri (strain MJ11)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 77% identity to vsa:VSAL_I2637)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (903 amino acids)

>CSW01_12125 protein translocase subunit SecA (Vibrio cholerae E7946 ATCC 55056)
MITKLLTKVIGSRNDRTLRRLRKIVKEINNYEPAFEALSDEELKAKTVEFRQRIEQGENL
DQLLPEAFATVREASKRVFGMRHFDVQLIGGMVLHGGQIAEMRTGEGKTLTATLAAYLNA
LPGKGVHIVTVNDYLAKRDAETNRPLFEFLGMTVGVNIPNMPQPAKKEAYQADILYGTNN
EFGFDYLRDNMAFRPEDRVQRARFFAVVDEVDSILIDEARTPLIISGPAEDSSDLYIRIN
KLIPLLQKQDKEDSEEYRGDGHFTVDEKSKQVHLTETGQEFVEELLVKNGMMQEGDTLYS
PANISLLHHVNAALRAHVLFEKNVDYIVTPDGEVVIVDEHTGRTMPGRRWSDGLHQAVEA
KEGVKIQNENQTLASITFQNYFRLYEKLSGMTGTADTEAFEFQQIYGLETVVIPTNKPMV
RNDMPDVVYRSEAEKFAAIIEDIKQRVEKGQPVLVGTVSIEKSELLSNALKKAGIKHNVL
NAKFHEKEAEIVAEAGKPGAVTIATNMAGRGTDIVLGGSWQAKVEKLDNPTQEQIDAIKA
EWKQVHDQVLQAGGLHIIGTERHESRRIDNQLRGRSGRQGDAGSSRFYLSMEDTLLRIFT
SDRMAALIQSGMDEGEAIESKMLSRSIEKAQRKVEGRNFDIRKQLLEYDDVANDQRKVVY
ELRDELMSADDISDMIAQNREDVLNAVMDEYIPPQSLEDMWDIKGLEDRLKNDFDLPLPI
QSWLDADNKLYEEALRERIIEQAVEVYKAKEQAVSPAVMRNFEKSVMLQTLDTLWKEHLA
AMDHLRQGIHLRGYAQKNPKQEYKRESFELFEDLLESLKSDVITVLSKVRVQQQEEVERM
EAQRRAQAEEAARHAQAQHASADDAEQDESNQPMVRDERKVGRNEPCPCGSGKKYKQCHG
QIN