Protein Info for CSW01_12045 in Vibrio cholerae E7946 ATCC 55056

Annotation: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01704: MTA/SAH nucleosidase
  • amino acids 2 to 228 (227 residues), 331 bits, E=1.8e-103
• PF01048: PNP_UDP_1
  • amino acids 2 to 227 (226 residues), 193.9 bits, E=1.4e-61

Best Hits

Swiss-Prot: 100% identical to MTNN_VIBCH: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (mtnN) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01243, S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase [EC: 3.2.2.9] (inferred from 100% identity to vco:VC0395_A1957)

MetaCyc: 100% identical to 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase monomer (Vibrio cholerae)
Methylthioadenosine nucleosidase. [EC: 3.2.2.16, 3.2.2.9]; 3.2.2.9 [EC: 3.2.2.16, 3.2.2.9]

Predicted SEED Role

No annotation

MetaCyc Pathways

• S-adenosyl-L-methionine salvage I (4/4 steps found)
• autoinducer AI-2 biosynthesis II (Vibrio) (5/6 steps found)
• autoinducer AI-2 biosynthesis I (4/5 steps found)
• S-methyl-5'-thioadenosine degradation IV (1/1 steps found)
• S-methyl-5'-thioadenosine degradation I (1/2 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• 5'-deoxyadenosine degradation II (1/4 steps found)
• L-methionine salvage cycle II (plants) (2/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (2/12 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.16 or 3.2.2.9

Protein Sequence (231 amino acids)

>CSW01_12045 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (Vibrio cholerae E7946 ATCC 55056)
MKIGIIGAMQQEVAILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTA
LLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFK
ADEKLMTVAEQALAQLPNTHAVRGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIA
QTCHQFKVPFVVVRAISDVADKESPLSFEEFLPLAAKSSSAMVLKMVELLK