Protein Info for CSW01_11935 in Vibrio cholerae E7946 ATCC 55056

Annotation: sodium:alanine symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 58 to 85 (28 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 388 to 410 (23 residues), see Phobius details amino acids 416 to 435 (20 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 441 (429 residues), 543.3 bits, see alignment E=2e-167 PF01235: Na_Ala_symp" amino acids 47 to 452 (406 residues), 567.5 bits, see alignment E=1.9e-174 PF03845: Spore_permease" amino acids 60 to 223 (164 residues), 25.2 bits, see alignment E=7e-10

Best Hits

Swiss-Prot: 52% identical to YAAJ_ECOLI: Uncharacterized transporter YaaJ (yaaJ) from Escherichia coli (strain K12)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to vcm:VCM66_2279)

Predicted SEED Role

"Sodium/alanine symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>CSW01_11935 sodium:alanine symporter family protein (Vibrio cholerae E7946 ATCC 55056)
MTDLINLMNDLLWGSILVYLLVGVGIYFTLRLGFIQFRHFTHTFTVLKNSRKADNAGISS
FQALCTSLAARVGTGNMAGVAVALTAGGPGAIFWMWLIAMLGMATSFAESTLAQLYKTRD
KDGNYRGGPAYYMEKGLGMRWMGVLFSIFLIIAFGLVFNAVQANSITNAMKTAFGFEPML
IGIGIVLLTAFVIFGGIRKIARTAELIVPFMAFAYLAIALFVVVMNYEKVPDAISLIFKS
AFGLQEAAAGGLGYAIAQAMINGVKRGLFSNEAGMGSAPNAAASATPYPPHPASQGYVQM
LGVFIDTIVICTATVAIILMSGEYVPHGELTGIELTQRALSSQVGDWGGIFIAFAIFFFA
FTSIIANYSYAETNLIFLEHNNKKGLVLFRLVFLGMVMFGSLATLPTVWAMADVSMGLMA
IVNLVAILLLSGIVIKLAKDYNRQLDAGKVPTFDANDYPELKSQLEDGIWDNNKAS