Protein Info for CSW01_11910 in Vibrio cholerae E7946 ATCC 55056

Annotation: 2-deoxyribose-5-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF01791: DeoC" amino acids 11 to 240 (230 residues), 151.1 bits, see alignment E=2e-48 TIGR00126: deoxyribose-phosphate aldolase" amino acids 11 to 231 (221 residues), 270.8 bits, see alignment E=3.5e-85

Best Hits

Swiss-Prot: 100% identical to DEOC_VIBC3: Deoxyribose-phosphate aldolase (deoC) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 100% identity to vch:VC2350)

MetaCyc: 80% identical to deoxyribose-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
Deoxyribose-phosphate aldolase. [EC: 4.1.2.4]

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>CSW01_11910 2-deoxyribose-5-phosphate aldolase (Vibrio cholerae E7946 ATCC 55056)
MSELKVAALRALKLMDLTTLNDNDTDAKVIQLCHDAKSPVGNTAAICIYPRFIPIAKKTL
REQGTPEIRIATVTNFPHGNDDIEIAVAETKAAVAYGADEVDVVFPYRALIAGNEQVGFD
LVKQCKAACGDKVLLKVIIETGELKQEALIKKASQICIEAGADFIKTSTGKVPVNATPEY
ARMMLEVIRDMGVAKTVGFKPAGGVRTAEDAQQYLAMADEILGGDWADSRHYRFGASSLL
TNLLNTLEVTDQKADPAAY