Protein Info for CSW01_11815 in Vibrio cholerae E7946 ATCC 55056

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 160 to 178 (19 residues), see Phobius details PF13673: Acetyltransf_10" amino acids 20 to 127 (108 residues), 62.9 bits, see alignment E=7.9e-21 PF00583: Acetyltransf_1" amino acids 30 to 123 (94 residues), 68.6 bits, see alignment E=1.5e-22 PF13508: Acetyltransf_7" amino acids 40 to 124 (85 residues), 54.3 bits, see alignment E=3.6e-18 PF08445: FR47" amino acids 65 to 126 (62 residues), 32.2 bits, see alignment E=2.2e-11 PF11814: DUF3335" amino acids 157 to 359 (203 residues), 253 bits, see alignment E=4.9e-79

Best Hits

KEGG orthology group: None (inferred from 99% identity to vco:VC0395_A1911)

Predicted SEED Role

"GNAT family acetyltransferase VC2332"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>CSW01_11815 GNAT family N-acetyltransferase (Vibrio cholerae E7946 ATCC 55056)
MDIRRANSADLNALNALEQQLFDGDRISPRQMKRFLHSDHAALFVADAGDQLAGYALLLF
HQGTQLSRLYSIAVKPEFRGQRIAQSLVEQCERAALDQGSTTLRLEVREDNTAALKLYEK
MGYKTLKLLIHYYDDLCDGRRMQKRLTPQESKVLLPMPLYVQTTPFTCGAACLLMSFACL
DKTFEPSRTQEMQLWREATTIFMAAGHGGCSGQGLALAAARRGYHVELWNQSRSTPFIDS
VRDPNKKQIIELVHQDFCQQLAEQDVSMIDAPPSQAQLEEWVRKGACVLLLISTYRFDGK
KEPHWIVLSGLSDKFFFFHDPHAESEEHVSGSGYIPVGKAALSQIIGFGKQKQIACVVIT
PRL