Protein Info for CSW01_11805 in Vibrio cholerae E7946 ATCC 55056

Annotation: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR03536: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase" amino acids 3 to 343 (341 residues), 589.2 bits, see alignment E=1e-181 PF14790: THDPS_N" amino acids 77 to 129 (53 residues), 26.4 bits, see alignment 8.2e-10 PF14789: THDPS_M" amino acids 131 to 171 (41 residues), 58.1 bits, see alignment 1.1e-19 PF14602: Hexapep_2" amino acids 253 to 285 (33 residues), 50.5 bits, see alignment 2e-17

Best Hits

Swiss-Prot: 100% identical to DAPD_VIBCH: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00674, 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC: 2.3.1.117] (inferred from 100% identity to vch:VC2329)

Predicted SEED Role

"2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117)" in subsystem Lysine Biosynthesis DAP Pathway (EC 2.3.1.117)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.117

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>CSW01_11805 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (Vibrio cholerae E7946 ATCC 55056)
MAYFALGLATATKNRDGKIIEAFFPTPILAPSDALVAALAPIAGYQEGNQALDITAAQSA
QLAAVFAAHQQAASAAFADKAANAKQPLVLVILASDDKPQSVAEGYLKLQLISHRLVKPH
GTVLDGIFGLLHNIAWTNEGPIDLPELAERQIEARLAGRVLTVDCVDKFPKMVDYVVPAG
IRIADTSRVRLGAHVGEGTTVMHEGFINFNAGTTGVSMVEGRISAGVVVGNGSDIGGGAS
IMGTLSGGGKVVVSIGENSLLGANAGLGFPLGDRCTVESGLYVTAGTKVRTLDKDGNQVD
IVKARDLAGVSDLLFRRNSLTGQIECLANKSAVELNSELHKNN