Protein Info for CSW01_11790 in Vibrio cholerae E7946 ATCC 55056

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details amino acids 29 to 30 (2 residues), see Phobius details transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details PF03595: SLAC1" amino acids 19 to 307 (289 residues), 97.6 bits, see alignment E=4.1e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_002022)

Predicted SEED Role

"Tellurite resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>CSW01_11790 C4-dicarboxylate ABC transporter (Vibrio cholerae E7946 ATCC 55056)
MIRAAKAKVMGAPTPMAGLALGIASLGWSWENMIAAHGVAQWVGAAIASVLLIVLAFKFL
WHGHLLRQDLAHPVVGSVVPTFAMATMVVSASLGHFYPVAGDALWLFAVGLHILFLVSFL
YHRAQAFELHHMVPSWFVPPVGIIVADVSFSGHPALAPIAYACLVFGMLAYAVMLPMMIY
RFIFTHEIPDAAKPTLAIMAAPASLSLAGYLTVVSEPSPVIVALLFGIAVLMTAIIYLAF
TRLLRLPFSPGYAAFTFPMVIGATALFKMAHWMENIGVAEHYVAQVHWLASLELIVATVV
VSYVAIRYLAFYQPHKVLVGSR