Protein Info for CSW01_11765 in Vibrio cholerae E7946 ATCC 55056

Annotation: amino-acid N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 TIGR01890: amino-acid N-acetyltransferase" amino acids 19 to 456 (438 residues), 760.4 bits, see alignment E=2.9e-233 PF00696: AA_kinase" amino acids 36 to 282 (247 residues), 102 bits, see alignment E=6.5e-33 PF00583: Acetyltransf_1" amino acids 342 to 427 (86 residues), 32.8 bits, see alignment E=1.1e-11 PF13508: Acetyltransf_7" amino acids 349 to 428 (80 residues), 27.6 bits, see alignment E=4.7e-10

Best Hits

Swiss-Prot: 100% identical to ARGA_VIBCH: Amino-acid acetyltransferase (argA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K14682, amino-acid N-acetyltransferase [EC: 2.3.1.1] (inferred from 100% identity to vco:VC0395_A1901)

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>CSW01_11765 amino-acid N-acetyltransferase (Vibrio cholerae E7946 ATCC 55056)
MRIFKHQGCSAVKIRSTALVKGFRQSAPYVNAHRGKTMVVMLGGEAIADKNFPNIISDIA
LLHSLGVKVVLVHGARPQINQILEKNQRDTPYHKGVRITDESSLGLVMQAAGQLQHAITA
RLSMSLNNTPMAGTQLNVVSGNFIISQPLGIDEGVDYCHSGRIRRIDVEGINRMLDLGSI
VLLGPIASSVTGECFNLLSEEVATQVAIKLKADKLIGFCPQQGIIDTKGNAIAELFPSDV
ERLVKSMEQECAPDDEECFSTMRFLRAALKACRAGVPRSHLVSYKEDGALIQELFSFDGI
GTQIVMASAEQIRQATIDDIGGIFDLIRPLEEQGILVRRSREQLEQEIHKFTIIDKDGLV
IGCSALYPYPEERMAEMACVAIHPEYRDGHRGLHLLVHSKHQAKQMGIRHLFVLTTHSTH
WFREQGFNEVDVEALPMAKKSLYNYQRRSKILMLQL