Protein Info for CSW01_11740 in Vibrio cholerae E7946 ATCC 55056

Annotation: cysteine desulfurase CsdA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03392: cysteine desulfurase, catalytic subunit CsdA
  • amino acids 4 to 403 (400 residues), 520.9 bits, E=2.5e-160
• TIGR01979: cysteine desulfurase, SufS family
  • amino acids 6 to 401 (396 residues), 558.8 bits, E=6.8e-172
• PF00266: Aminotran_5
  • amino acids 24 to 392 (369 residues), 525.8 bits, E=5.9e-162
• PF01041: DegT_DnrJ_EryC1
  • amino acids 62 to 207 (146 residues), 21.5 bits, E=1.3e-08

Best Hits

Swiss-Prot: 100% identical to CSD_VIBCH: Probable cysteine desulfurase (csd) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01766, cysteine sulfinate desulfinase [EC: 4.4.1.-] (inferred from 100% identity to vcj:VCD_002034)

MetaCyc: 45% identical to L-cysteine desulfurase (Escherichia coli K-12 substr. MG1655)
Selenocysteine lyase. [EC: 4.4.1.16]; Cysteine desulfurase. [EC: 4.4.1.16, 2.8.1.7]

Predicted SEED Role

"Cysteine desulfurase CsdA-CsdE (EC 2.8.1.7), main protein CsdA" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
• superpathway of L-alanine biosynthesis (4/4 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• molybdopterin biosynthesis (5/6 steps found)
• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (6/11 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)

KEGG Metabolic Maps

• Selenoamino acid metabolism
• Thiamine metabolism
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.- or 4.4.1.16

Protein Sequence (403 amino acids)

>CSW01_11740 cysteine desulfurase CsdA (Vibrio cholerae E7946 ATCC 55056)
MLNLDAIRAQFPALQQIVNGNPLVYLDSAATTQKPQCVIDAISHYYSQHNANVHRGSHSL
TAQATSQFEGAREQVAQFIGAPSSKNIIWTRGATEALNLIAQSYARSTLQAGDEILVSET
EHHANIVPWQMVAEQTGAKVVKIPMTTTGEFGLAAFRQLLSPRCKIVALAHITNVTGTRQ
PIEAVIQAAHQQGAIVVIDGAQGIVHETVDVRALDADFYVFSGHKLYAPAGIGVLYGKTA
LLEAMPPWHGGGKMVEKVSFDGTTFTGLPGKFEAGTPNVAGAIALATAIDWYQSLDRAAV
EAHLHQLQQQAYQAISQIDDIRVLGYQPNASVLSLVMDGVHHQDLATLLDQQGIAVRAGH
HCAHPLMDAFGVKGTVRISFGVYNSAEEVERLIAAIHKAVDLL