Protein Info for CSW01_11725 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03502: Channel_Tsx" amino acids 30 to 266 (237 residues), 296.8 bits, see alignment E=7.7e-93

Best Hits

Swiss-Prot: 91% identical to OMPK_VIBPA: Outer membrane protein OmpK (ompK) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K05517, nucleoside-specific channel-forming protein (inferred from 100% identity to vcj:VCD_002037)

Predicted SEED Role

"Outer membrane protein OmpK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>CSW01_11725 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MRKSLLALSLLAATSAPVLAADYSDGDIHKNDYKWMQFNLMGAFDELPGKSSHDYLEMEF
GGRSGIFDLYGYVDVFNLATNKSSDKVGDPKIFMKFAPRMSLDAFTGVDMSFGPVQEVYV
ASLFEWDGTDFKTNAFSVNNQKIGLGSDVMVPWFGKVGLNLYGTYDGNRKDWNGFQISTN
WFKPFYFFENGSFISYQGYIDYQFGLKDEYSTASNGGAMFNGIYWHSDRFAVGYGLKGYK
DVYGIKDTDGFKSTGFGHYVAVTYKF