Protein Info for CSW01_11715 in Vibrio cholerae E7946 ATCC 55056

Annotation: RNA polymerase subunit sigma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 28 to 187 (160 residues), 99.3 bits, see alignment E=9.3e-33 PF04542: Sigma70_r2" amino acids 33 to 99 (67 residues), 61.4 bits, see alignment E=8.8e-21 PF08281: Sigma70_r4_2" amino acids 133 to 185 (53 residues), 46.9 bits, see alignment E=2.7e-16 PF04545: Sigma70_r4" amino acids 139 to 186 (48 residues), 52.8 bits, see alignment E=3.4e-18

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to vch:VC2302)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>CSW01_11715 RNA polymerase subunit sigma (Vibrio cholerae E7946 ATCC 55056)
MFNPSPHTFGRQEWLECMEKVKSRDTQAFALVFSYYSPKLKQFVMKHVGSEQVALELVQE
TMSTVWQKASLFDGQKSSLATWIYTIARNLSYDLLRRQKGRDAYVLADDIWPEDYCPPDL
VDHYAPEQDLLKEQVMKFLDRLPEAQQQVIKAVYLEEIPQQDVADMLDIPLGTVKSRLRL
AVEKLRLSMDAESL