Protein Info for CSW01_11660 in Vibrio cholerae E7946 ATCC 55056

Annotation: NADH:ubiquinone reductase (Na(+)-transporting) subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details TIGR01939: NADH:ubiquinone oxidoreductase, Na(+)-translocating, D subunit" amino acids 3 to 207 (205 residues), 359.8 bits, see alignment E=2.3e-112 PF02508: Rnf-Nqr" amino acids 9 to 195 (187 residues), 214.2 bits, see alignment E=6.6e-68

Best Hits

Swiss-Prot: 100% identical to NQRD_VIBC3: Na(+)-translocating NADH-quinone reductase subunit D (nqrD) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K00349, Na+-transporting NADH:ubiquinone oxidoreductase subunit D [EC: 1.6.5.-] (inferred from 100% identity to vcj:VCD_002049)

MetaCyc: 100% identical to Na(+)-translocating NADH-quinone reductase subunit D (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit D (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>CSW01_11660 NADH:ubiquinone reductase (Na(+)-transporting) subunit D (Vibrio cholerae E7946 ATCC 55056)
MSSAKELKKSVLAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVMFVTALSNFFVS
LIRNHIPNSVRIIVQMAIIASLVIVVDQILKAYLYDISKQLSVFVGLIITNCIVMGRAEA
FAMKSEPIPSFIDGIGNGLGYGFVLMTVGFFRELLGSGKLFGLEVLPLISNGGWYQPNGL
MLLAPSAFFLIGFMIWAIRTFKPEQVEAKE