Protein Info for CSW01_11655 in Vibrio cholerae E7946 ATCC 55056

Annotation: NADH:ubiquinone reductase (Na(+)-transporting) subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details TIGR01940: NADH:ubiquinone oxidoreductase, Na(+)-translocating, E subunit" amino acids 2 to 197 (196 residues), 354.8 bits, see alignment E=9.7e-111 PF02508: Rnf-Nqr" amino acids 4 to 196 (193 residues), 201.8 bits, see alignment E=4.4e-64

Best Hits

Swiss-Prot: 100% identical to NQRE_VIBCH: Na(+)-translocating NADH-quinone reductase subunit E (nqrE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00350, Na+-transporting NADH:ubiquinone oxidoreductase subunit E [EC: 1.6.5.-] (inferred from 100% identity to vcm:VCM66_2214)

MetaCyc: 100% identical to Na(+)-translocating NADH-quinone reductase subunit E (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit E (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>CSW01_11655 NADH:ubiquinone reductase (Na(+)-transporting) subunit E (Vibrio cholerae E7946 ATCC 55056)
MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGIAVIVVLTISVPVNNLVY
NLVLKPDALVEGVDLSFLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNC
AIFGGVSFMVQRDYSFAESVVYGFGSGVGWMLAIVALAGIREKMKYSDVPPGLRGLGITF
ITAGLMALGFMSFSGVQL