Protein Info for CSW01_11610 in Vibrio cholerae E7946 ATCC 55056

Annotation: 30S ribosomal protein S6--L-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF18030: Rimk_N" amino acids 1 to 94 (94 residues), 158.8 bits, see alignment E=8.8e-51 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 2 to 286 (285 residues), 291.1 bits, see alignment E=4.2e-91 PF08443: RimK" amino acids 98 to 286 (189 residues), 233.2 bits, see alignment E=4.6e-73 PF02655: ATP-grasp_3" amino acids 99 to 263 (165 residues), 31 bits, see alignment E=6.4e-11 PF02955: GSH-S_ATP" amino acids 114 to 262 (149 residues), 62.6 bits, see alignment E=8.7e-21

Best Hits

Swiss-Prot: 100% identical to RIMK_VIBCH: Probable alpha-L-glutamate ligase (rimK) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K05844, ribosomal protein S6 modification protein (inferred from 100% identity to vco:VC0395_A1871)

MetaCyc: 68% identical to ribosomal protein S6 modification protein (Escherichia coli K-12 substr. MG1655)
6.3.2.-

Predicted SEED Role

"Ribosomal protein S6 glutaminyl transferase" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>CSW01_11610 30S ribosomal protein S6--L-glutamate ligase (Vibrio cholerae E7946 ATCC 55056)
MKIGILSRNASLYSTKRLIEACKQRGHEVRVIDALRCYMNINSDKPEIHYKGEELAGFDA
VIPRIGASVTFYGTAVLRQFEMMGVYPANESVAITRSRDKLRSMQLLSRRGIGMPITGFA
SKPDDVKDLLDMVGGAPVVIKLLEGTQGIGVVLAETRTAAESVIEAFMGLKANIMVQEYI
KEAGGADIRCFVIGDKVIAAMKRQGADGEFRSNLHRGGTASLVKITPQERKTAIEAAKIM
GLNVAGVDLLRSARGPLVMEVNSSPGLEGIEAATGKDIAGMIVEFIEKNAASKRTKTRGK
G