Protein Info for CSW01_11575 in Vibrio cholerae E7946 ATCC 55056

Annotation: glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01027: glutamate 5-kinase
  • amino acids 12 to 374 (363 residues), 494.4 bits, E=1e-152
• PF00696: AA_kinase
  • amino acids 13 to 241 (229 residues), 160.9 bits, E=4.4e-51
• PF01472: PUA
  • amino acids 284 to 358 (75 residues), 86 bits, E=1.4e-28

Best Hits

Swiss-Prot: 100% identical to PROB_VIBCH: Glutamate 5-kinase (proB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 100% identity to vch:VC2274)

MetaCyc: 67% identical to glutamate 5-kinase (Escherichia coli K-12 substr. MG1655)
Glutamate 5-kinase. [EC: 2.7.2.11]

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (3/3 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-N^δ-acetylornithine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Protein Sequence (377 amino acids)

>CSW01_11575 glutamate 5-kinase (Vibrio cholerae E7946 ATCC 55056)
MTTNQRSIKAPQTVVVKLGTSVLTGGTLALDRAHMVELARQCAELKKQGHSVVIVTSGAI
AAGREHLGYPALPNAISSKQLLAAVGQSRLIQVWESLFAIYGIKIGQMLLTRADLDDRER
FLNARDTINALVENGIVPVVNENDAVATNEIKVGDNDNLSALVGILCGADKLLLLTDQKG
LFTADPRKDPNAQLIKEVTTIDDTLRKIAGGSGTTLGTGGMATKLQAADIARRAGIEVII
AAGRAPNVIFDSLSDEPQGTRFLALEEALENRKRWILAGPAASGDIVIDDGAVKAVQTKG
SSLLAKGVVRVQGQFARGEVVRVLDKQSHLIARGIAAYSNDELAQIAGKHSKEIIDILGY
DHGSEVIHRDDMVVIQE