Protein Info for CSW01_11535 in Vibrio cholerae E7946 ATCC 55056

Annotation: thiamine-phosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 13 to 330 (318 residues), 349.3 bits, E=8.8e-109
• PF00586: AIRS
  • amino acids 37 to 145 (109 residues), 96.2 bits, E=1.7e-31
• PF02769: AIRS_C
  • amino acids 159 to 311 (153 residues), 36.7 bits, E=4.7e-13

Best Hits

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 100% identity to vch:VC2266)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate salvage I (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Protein Sequence (334 amino acids)

>CSW01_11535 thiamine-phosphate kinase (Vibrio cholerae E7946 ATCC 55056)
MQRFNQRVWMMFGEFNLIDKYFSNRQAQRKDVHLALGDDCAIVKVPENSRVAISTDTLVA
GTHFLAQANPAWVAHKALASNISDLAAMGATPAWVSLALTLPEIDDAWLTPFCDAFFELA
KYYNVQLIGGDTTKGPLSITLTVQGFLPKEQAMLRSGAKVGDWLYVTGDLGDSQAGLDVI
LDPEKRHLPFADILEQRHYLSTPRIVAGQALVHLASSAIDISDGLIADLQHILRRSNVGA
SIDVSLLPLSKELLQFVDSVTSAQQYALTSGEEYELCFTIPEENRGSLENALAHCGTKVT
CIGQIRPAGTFELHNQGKKLDWQLAGYDHFKVKA