Protein Info for CSW01_11475 in Vibrio cholerae E7946 ATCC 55056

Annotation: zinc metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details amino acids 428 to 447 (20 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 4 to 452 (449 residues), 462 bits, see alignment E=8.9e-143 PF02163: Peptidase_M50" amino acids 10 to 439 (430 residues), 260.4 bits, see alignment E=1.7e-81 PF00595: PDZ" amino acids 227 to 268 (42 residues), 29.8 bits, see alignment 9.7e-11 PF17820: PDZ_6" amino acids 228 to 279 (52 residues), 39.8 bits, see alignment 4.6e-14

Best Hits

Swiss-Prot: 100% identical to Y2253_VIBCH: Putative zinc metalloprotease VC_2253 (VC_2253) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 100% identity to vco:VC0395_A1844)

Predicted SEED Role

"Membrane-associated zinc metalloprotease" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>CSW01_11475 zinc metalloprotease (Vibrio cholerae E7946 ATCC 55056)
MTDILWNFIAFIIALGILVAVHEFGHFWVARRCGVKVEKFSIGFGKSIWKRVGHDGTEYS
ISMIPLGGYVKMLDGRVDDVPAEQQAMAFDKQSLWKRSAIVSAGPIFNFLFAIFAYWLVF
MIGVPAVKPVIGEVTPYSIAAQAGLEPGMEIKAVSGVNTPDWESVNMGLIGHIGDDSMTI
TVSSAEGVGLNEIKTINLRDWNFDPETESAMGALGFKPFTPEISNQLTNVSAQGAGERAG
LQVGDTVLQINGQAVEAWQQVVNAIQSHPNAPIAVMVERAGQQVELTLIPDSRELSQGKV
IGFAGIAPKVAEWPQNYRFELQFGVFESLGKAVEKSGQVIDLTVSMLKKLLVGDVGLNNL
SGPISIAKGAGTTADYGFVYFLGFLALISINLGIINLVPLPMLDGGHLLFFMIEAVIRRP
VPEKVQEMGYRIGGAIIFSLMAVAIFNDFTRL