Protein Info for CSW01_11450 in Vibrio cholerae E7946 ATCC 55056

Annotation: acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00132: Hexapep" amino acids 2 to 32 (31 residues), 29.4 bits, see alignment 4.7e-11 amino acids 109 to 143 (35 residues), 35.3 bits, see alignment 6.2e-13 TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase" amino acids 8 to 260 (253 residues), 365.1 bits, see alignment E=8.2e-114 PF13720: Acetyltransf_11" amino acids 180 to 261 (82 residues), 107.1 bits, see alignment E=5e-35

Best Hits

Swiss-Prot: 100% identical to LPXA_VIBCM: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 100% identity to vco:VC0395_A1839)

MetaCyc: 100% identical to acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase (Vibrio cholerae O1 biovar El Tor str. N16961)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>CSW01_11450 acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase (Vibrio cholerae E7946 ATCC 55056)
MIHETAQIHPTSVVEEGAIIGANVKIGPFCFVDSKVEIGEGTELLSHVVVKGPTKIGRFN
RIFQFASIGEACQDLKYAGEDTQLIIGDRNTIRESVTMHRGTVQDKGITIVGSDNLFMIN
AHVAHDCVIGDRCIFANNATLAGHVKVGNQAIVGGMSAIHQFCHIGDHCMLGGGSIVVQD
VPPYVMAQGNHCAPFGINVEGLKRRGFDKAEIHAIRRAYKSLYRNGLTLEAAKAEIAQEA
EQYPSVKLFLDFLEKSERGIIR