Protein Info for CSW01_11425 in Vibrio cholerae E7946 ATCC 55056

Annotation: tRNA(Ile)-lysidine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details PF01171: ATP_bind_3" amino acids 19 to 198 (180 residues), 216.4 bits, see alignment E=4e-68 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 19 to 201 (183 residues), 180.1 bits, see alignment E=4.4e-57 PF09179: TilS" amino acids 246 to 313 (68 residues), 69.6 bits, see alignment E=3.3e-23 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 362 to 408 (47 residues), 53.6 bits, see alignment 1.1e-18 PF11734: TilS_C" amino acids 364 to 428 (65 residues), 76.4 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 100% identical to TILS_VIBCH: tRNA(Ile)-lysidine synthase (tilS) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 100% identity to vco:VC0395_A1834)

MetaCyc: 46% identical to tRNAIle-lysidine synthetase (Escherichia coli K-12 substr. MG1655)
RXN-1961 [EC: 6.3.4.19]

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>CSW01_11425 tRNA(Ile)-lysidine synthetase (Vibrio cholerae E7946 ATCC 55056)
MDDLYLHFVQQLARYPFRKILLALSGGVDSQVLLALLARGRDEFGWDVTAVHVHHGLSPN
ADQWAQYCQRCCREVGMACQIEYVQLDVASGESIEKLAREARYRVLAPHVNAQTLLLLGQ
HADDQLETFLLALKRGSGPKGLAAMAAYAPFAEGHLLRPLLTVSRQHIEAYAKQHKLTWV
IDESNADIRYERNFLRHQVTPVLTERWPSIRQAVQRSAELCAEQEALLQEFLAEALKKAI
TAEGGLSIAVLAEGSEGMRRQLIRAWFAHHRLPMPSRQHTERIWCEVALASEDANPKLKL
NHIEVRRFQHCLYLVPPEKDLSGWRSALVPEQRLPLPQGLGHLQLTSKAGGNIKLPDDPS
QLWVSFEPQGLEACPVGRVGSRKLKKLFQEYGVPSWRRRQTPILMYQNRVVCVADLFVDR
DWSGQDCELVWFKSHDSVPK