Protein Info for CSW01_11345 in Vibrio cholerae E7946 ATCC 55056

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01091: uracil phosphoribosyltransferase
  • amino acids 3 to 208 (206 residues), 305.2 bits, E=1.1e-95
• PF14681: UPRTase
  • amino acids 7 to 207 (201 residues), 233 bits, E=2.5e-73
• PF00156: Pribosyltran
  • amino acids 64 to 169 (106 residues), 50.5 bits, E=1.5e-17

Best Hits

Swiss-Prot: 100% identical to UPP_VIBC3: Uracil phosphoribosyltransferase (upp) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 100% identity to vch:VC2225)

MetaCyc: 86% identical to uracil phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Uracil phosphoribosyltransferase. [EC: 2.4.2.9]

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)
• pyrimidine nucleobases salvage II (1/2 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.9

Protein Sequence (208 amino acids)

>CSW01_11345 uracil phosphoribosyltransferase (Vibrio cholerae E7946 ATCC 55056)
MKIVEVKHPLVKHKLGLMREGDISTKRFRELATEVASLLTYEATSDFETEKVTIEGWNGP
VQVDQIKGKKVTVVPILRAGLGMMDGVLEHIPSARISVVGIYRDEETLEPVPYFNKLATN
IEERIAMVVDPMLATGGSMIATIDLLKEKGCNQIKVLVLVAAPEGIAALEKAHPDVELYT
AAIDEKLNDKGYIVPGLGDAGDKIFGTK