Protein Info for CSW01_11280 in Vibrio cholerae E7946 ATCC 55056

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 687 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details PF07715: Plug" amino acids 64 to 178 (115 residues), 49.1 bits, see alignment E=7.4e-17 TIGR01783: TonB-dependent siderophore receptor" amino acids 65 to 687 (623 residues), 373.1 bits, see alignment E=1.5e-115 PF00593: TonB_dep_Rec_b-barrel" amino acids 293 to 653 (361 residues), 109.7 bits, see alignment E=3.5e-35

Best Hits

Swiss-Prot: 100% identical to VIUA_VIBC3: Vibriobactin receptor (viuA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: None (inferred from 100% identity to vch:VC2211)

Predicted SEED Role

"Ferric vibriobactin receptor ViuA" in subsystem Iron acquisition in Vibrio

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (687 amino acids)

>CSW01_11280 TonB-dependent siderophore receptor (Vibrio cholerae E7946 ATCC 55056)
MAVLCPARVSVAENKKFKLHTLSAMMMGLFTGSFAYAETQNTSNQEQEMPVLVVIGEKTQ
RSIYETSASVEVFDQDTIERTPGATEIDDLLQLIPNLVDSGQSNNMPTIRGIDGSGPSVG
GLASFAGTSPRLNMSIDGRSLTYSEIAFGPRSLWDMQQVEIYLGPQSYIQGRNTSAGAIV
MKSNDPTHHFESAVKAGIGESDYSQTAGMISAPIIQDELAFRLSFDQQKRDSFVDLAAFE
PAGDPKKIEMNSVRGKLLYEPSALDGFKTTLTLSHMDSRGPQTENINVAGNEAFRPVYET
ASFTTAWDIIWHLNDLFTFENNLVYADFSYDRYTNPNSRGDFNTDGKEFHIEPLLRYIAL
DGSVNTLIGARYYQSSQDDMYIDAASAYPMDGRTKAKSVFAEVTYALTPSINVNLAGRFE
REQVKRNVSHPRYKLDYDETSSVFLPKLDVAYTPVQGQTYGIKAAKGYNASGAGLAFNSM
QFTGFRPYEFEQESIWNYEFYTRHRFSHSVEVLTNLFYNDFDSMQMTQTTSSGDVFIANL
DEASTYGAEIGSRWYATSSLELFANLGLLKTEFKETTGNTKELPRAPKMSANVGLLYDFG
QGFEFSSNAAYTGSYFSESGNSEKFAIDSYWVANAQLAYVFEHGRATLYATNLLDSDKTT
LYLSTNNTLDQLKQQPRMIGASVQLNF