Protein Info for CSW01_11240 in Vibrio cholerae E7946 ATCC 55056

Annotation: flagella basal body P-ring formation protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17656: ChapFlgA_N
  • amino acids 56 to 129 (74 residues), 49 bits, E=9.8e-17
• TIGR03170: flagella basal body P-ring formation protein FlgA
  • amino acids 121 to 253 (133 residues), 128.6 bits, E=8.2e-42
• PF08666: SAF
  • amino acids 135 to 194 (60 residues), 39.1 bits, E=1.3e-13
• PF13144: ChapFlgA
  • amino acids 135 to 253 (119 residues), 113.9 bits, E=7.6e-37

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 100% identity to vcm:VCM66_2126)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Protein Sequence (255 amino acids)

>CSW01_11240 flagella basal body P-ring formation protein FlgA (Vibrio cholerae E7946 ATCC 55056)
MKKPEKRKMHPKIDLHSHFITKCRAFCEIFYSFIGFLLFFFSLAANAATPEQLSMIKEAA
ENHVLSTVDMPAGGELVVNAANIDDRLFATDCPEPLTTNSSSSNGSAANITVLVECKPDN
WRVYVPVRLTITIPLITAATPLSRGQMISAQDVTLSMVDLLRFRRQGFSTPENVIGAKIK
KNIRVGDVIEQNDVCIVCRNESVVIRAGKSGMSITTKGTAMSDGVVGEQIKVKNDKSNRI
IDAQVSGVGEVTVAF