Protein Info for CSW01_11200 in Vibrio cholerae E7946 ATCC 55056

Annotation: flagellar basal-body rod protein FlgG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 137 (134 residues), 135.8 bits, see alignment E=3e-43 amino acids 147 to 244 (98 residues), 104 bits, see alignment E=1.4e-33 TIGR02488: flagellar basal-body rod protein FlgG" amino acids 4 to 261 (258 residues), 386.7 bits, see alignment E=5.3e-120 PF00460: Flg_bb_rod" amino acids 8 to 35 (28 residues), 33 bits, see alignment (E = 7.2e-12) PF22692: LlgE_F_G_D1" amino acids 96 to 160 (65 residues), 89.2 bits, see alignment E=2.4e-29 PF06429: Flg_bbr_C" amino acids 216 to 260 (45 residues), 67.3 bits, see alignment 1e-22

Best Hits

Swiss-Prot: 55% identical to FLGG_SALTY: Flagellar basal-body rod protein FlgG (flgG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 100% identity to vcm:VCM66_2118)

Predicted SEED Role

"Flagellar basal-body rod protein FlgG" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>CSW01_11200 flagellar basal-body rod protein FlgG (Vibrio cholerae E7946 ATCC 55056)
MQPALWVSKTGLDAQQTNIATISNNLANASTIGFKKGRAVFEDLFYQNINQPGAQSSQNT
RLPSGLMLGAGSKVVATQKVHTNGNVQTTSNSLDMMIEGDGFFQILMPDGNIAYSRNGQF
TLDDEGAIVTSGAGYRLQPEIIIPEDAISITIGNDGEVSVRVRGQQDNQVLGQITTVDFI
NPGGLEPVGQNLYLPTGASGEPQEGVPGLDGLGDIRQSMLETSNVNVTEELVNMIEAQRV
YEMNSKVISAVDKMMSFVNQQL