Protein Info for CSW01_11180 in Vibrio cholerae E7946 ATCC 55056

Annotation: flagellar hook-associated protein FlgK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 TIGR02492: flagellar hook-associated protein FlgK" amino acids 5 to 348 (344 residues), 198.5 bits, see alignment E=1.3e-62 PF00460: Flg_bb_rod" amino acids 15 to 35 (21 residues), 21.1 bits, see alignment (E = 5e-08) PF22638: FlgK_D1" amino acids 94 to 324 (231 residues), 192.6 bits, see alignment E=1.6e-60 PF21158: flgK_1st_1" amino acids 340 to 413 (74 residues), 33.4 bits, see alignment E=7.5e-12 PF06429: Flg_bbr_C" amino acids 583 to 623 (41 residues), 37.4 bits, see alignment 2.9e-13

Best Hits

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 100% identity to vch:VC2191)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (624 amino acids)

>CSW01_11180 flagellar hook-associated protein FlgK (Vibrio cholerae E7946 ATCC 55056)
MASDLLNVGTQSVLTAQRQLNTTGHNISNVNTEGYSRQSVIQGTNAPRQYGGETYGMGVH
VENVRRSWDQFAVKELNIASTDYAFKRDTEENLDMLSKLLSSVASKKIPENLNEWFDSVK
SLADSPNDLGARKVVLEKSKLISQNLNDFHETVRLQKDITNKGLALGVERINQLALEIRD
LQRLMMRVPGPHNDLMDKHEKLVSELSQYTKVTVTQRKHGEGFNIHIGNGHTLVSGTEAS
QLRVIDGFPDTQQHRLAMVEGKALKAISARDIGGKMEAILDMRDEHIPYLMDEVGRLALS
FSHEVNTLQSQGLDLRGNVGSALFTDVNLDVIARSRVVTNSNSKADMAVFIEDVSQLKGG
EYSMQYNGSEFVVTLPSGQQTVLPVVKGNVYVDGLRVEVRNPPQVGERILVRPTRNGAAA
IRLATEDATKIAAQSFEASTTFAQGKAKFKILQAGDVREFEVIVSPTGDQFAVTDTKGNI
LLQPQPYPPTGPVTVLGTTFELTEGALPNDKFTANLVPSEGDNGNLRKMINIQTAKRMND
NESTIIDLYHNLNTDVGLKMATMTRLTDVARLEKEAAQSRIASISGVNLDEEAANMMKFQ
QAYMASSRIIQASNDTFNTILALR