Protein Info for CSW01_10790 in Vibrio cholerae E7946 ATCC 55056

Annotation: arsenate reductase (glutaredoxin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00014: arsenate reductase (glutaredoxin)
  • amino acids 3 to 116 (114 residues), 151.3 bits, E=7.4e-49
• PF03960: ArsC
  • amino acids 6 to 115 (110 residues), 88.2 bits, E=1.8e-29

Best Hits

Swiss-Prot: 62% identical to YFGD_ECOLI: Uncharacterized protein YfgD (yfgD) from Escherichia coli (strain K12)

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 100% identity to vcj:VCD_002210)

MetaCyc: 47% identical to arsenate reductase (Escherichia coli K-12 substr. MG1655)
Arsenate reductase (glutaredoxin). [EC: 1.20.4.1]

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

• arsenate detoxification III (2/2 steps found)
• arsenic detoxification (bacteria) (2/4 steps found)
• arsenate detoxification I (3/6 steps found)
• arsenic detoxification (plants) (3/6 steps found)
• arsenic detoxification (yeast) (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.20.4.1

Protein Sequence (116 amino acids)

>CSW01_10790 arsenate reductase (glutaredoxin) (Vibrio cholerae E7946 ATCC 55056)
MSVVIYHNPKCSKSRETLALLENQGIAPQVIKYLETSPSVEELKRLYQQLGLNEVRAMMR
CKEELYKELNLGDSQLSDDALFAAMAEHPKLIERPIVVCNGQARHGRPPEQVLEIL