Protein Info for CSW01_10650 in Vibrio cholerae E7946 ATCC 55056

Annotation: flagellar basal body M-ring protein FliF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 transmembrane" amino acids 52 to 76 (25 residues), see Phobius details amino acids 474 to 492 (19 residues), see Phobius details TIGR00206: flagellar M-ring protein FliF" amino acids 53 to 579 (527 residues), 259.3 bits, see alignment E=4.7e-81 PF01514: YscJ_FliF" amino acids 77 to 249 (173 residues), 175.6 bits, see alignment E=9.5e-56 PF08345: YscJ_FliF_C" amino acids 282 to 452 (171 residues), 138.3 bits, see alignment E=2.8e-44

Best Hits

KEGG orthology group: K02409, flagellar M-ring protein FliF (inferred from 100% identity to vco:VC0395_A1717)

Predicted SEED Role

"Flagellar M-ring protein FliF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (580 amino acids)

>CSW01_10650 flagellar basal body M-ring protein FliF (Vibrio cholerae E7946 ATCC 55056)
MADDKQTTDLALTNSGGEHALMAGSDMDHDTQNPDINEKSSKMDFTVGDLDLLRQVVLVL
SISICVALIVMLFFWVREPDMRPLGAYETEELIPVLDYLDQQKQQYKLDGNTILVPVSDY
NSLKLSMVRAGLNQNRQAGDEILMQDMGFGVSQRLEQERLKLSRERQLAKAIEEMRQVNK
ARVLLALPKQSVFVRHNQEASASVFLTVRTGANLKQEEIDAVVDMVASAVPGMKPSRVTV
TDQHGRLLSSGSQDPVSAARRKEQELEKQQEEALRGKIDSVLIPILGLGNYTAQVDIELD
FSAVEQTRKVFDPNTPATRSEYTLEDYNNGNVVAGVPGALSNQPPADASIPQDVAQMKDG
SVMGQGSVHKEATRNYELDTTISHERKQSGVINRQTVAVAVKSRSSVNPDTGEVTYTPLS
EADLNSIRQVLIGTVGYSENRGDLLNVLSMPFAEPEMEQIVDVPIWEHPNFNDWVRWFAS
ALVIIIVILVLVRPAMKKLINPAADNDDQMYGPDGMPIGADGETSLIGSDIDGGELFEFG
SGIDLPNLHKDEDVLKAVRALVANEPELAAQVVKNWMQNG