Protein Info for CSW01_10635 in Vibrio cholerae E7946 ATCC 55056

Annotation: flagellum-specific ATP synthase FliI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 TIGR01026: ATPase, FliI/YscN family" amino acids 21 to 437 (417 residues), 577.1 bits, see alignment E=2.3e-177 TIGR03496: flagellar protein export ATPase FliI" amino acids 24 to 435 (412 residues), 642.9 bits, see alignment E=2e-197 PF00006: ATP-synt_ab" amino acids 146 to 357 (212 residues), 293.7 bits, see alignment E=8.4e-92 PF18269: T3SS_ATPase_C" amino acids 364 to 434 (71 residues), 75.7 bits, see alignment E=2.1e-25

Best Hits

Swiss-Prot: 60% identical to FLII_PSEAE: Flagellum-specific ATP synthase (fliI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 100% identity to vco:VC0395_A1714)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>CSW01_10635 flagellum-specific ATP synthase FliI (Vibrio cholerae E7946 ATCC 55056)
MLALADRLAQYKVEGHTTRPMASGKLVRVVGLTLEATGCKAPVGSLCKVETMNGEMEAEV
VGFSGDNLFLMPSEQIIGVLPGAKVTPITTESGLPVGMELLGRVIDGVGNPLDGLGPIYT
DQRASLNAIPINPLARKPINEPLDVGIKAINGLLTVGKGQRIGLFAGSGVGKSVTLGMMT
RGTTAQVVVVGLIGERGREVKEFIEEILGVDGRQRSVVVAAPADSSPLMRLKGCQTALTI
AEYFRDQGLDVLLLMDSLTRFAQAQREIALSVGEPPATKGYPPSVFAKLPALVERAGNGG
PHQGSITAFFTVLTEGDDLQDPIADASRAILDGHIVLSREMADAGHYPAIDVEKSVSRVM
PQITTDEHLLMSKAVRQILSVCRKNQDLVSIGAYKPGTDKAIDAAFTLKPKLDQYLQQAM
KETVPYDMCVNMLRHVLSS