Protein Info for CSW01_10585 in Vibrio cholerae E7946 ATCC 55056

Annotation: flagellar type III secretion system protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 66 to 67 (2 residues), see Phobius details amino acids 79 to 104 (26 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 147 to 153 (7 residues), see Phobius details amino acids 174 to 202 (29 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 12 to 256 (245 residues), 265.8 bits, see alignment E=2e-83 PF01311: Bac_export_1" amino acids 13 to 246 (234 residues), 198.4 bits, see alignment E=6.6e-63

Best Hits

Swiss-Prot: 39% identical to FLIR_ECOLI: Flagellar biosynthetic protein FliR (fliR) from Escherichia coli (strain K12)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 100% identity to vco:VC0395_A1703)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>CSW01_10585 flagellar type III secretion system protein FliR (Vibrio cholerae E7946 ATCC 55056)
MEYPASVVLDFIANYFWPYTRIAAMLMVMTVTGARFVPARVRLYLGLALTFAVMPAIPAV
PSDIALLSLQGFMITFEQIVIGVAMGMVTQFLVQIFVMLGQILGMQSSLGFASMVDPANG
QNTPLLGQLFMLLATLFFLVSDGHLKMIQLVVFSFKSLPIGSGSLTTVDFRELALWLGIM
FKASLAVSLSGIIALLTVNLSFGVMTRAAPQLNIFSLGFSFALLVGLLLCWYIVHGLYTH
YDIYWQEAEEQVCRLIRLNC