Protein Info for CSW01_10560 in Vibrio cholerae E7946 ATCC 55056

Annotation: chorismate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00033: chorismate synthase
  • amino acids 10 to 350 (341 residues), 480.9 bits, E=1.1e-148
• PF01264: Chorismate_synt
  • amino acids 10 to 345 (336 residues), 480.5 bits, E=9.4e-149

Best Hits

Swiss-Prot: 100% identical to AROC_VIBC3: Chorismate synthase (aroC) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K01736, chorismate synthase [EC: 4.2.3.5] (inferred from 100% identity to vcj:VCD_002254)

MetaCyc: 80% identical to chorismate synthase (Escherichia coli K-12 substr. MG1655)
Chorismate synthase. [EC: 4.2.3.5]

Predicted SEED Role

"Chorismate synthase (EC 4.2.3.5)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 4.2.3.5)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.5

Protein Sequence (361 amino acids)

>CSW01_10560 chorismate synthase (Vibrio cholerae E7946 ATCC 55056)
MAGNSIGQHFRVTTFGESHGIALGCIVDGCPPGLTISEADLQVDLDRRRPGTSRYTTQRR
EPDEVKILSGVFEGKTTGTSIGLLIENTDQRSKDYSDIKDKFRPGHADYTYHQKYGVRDY
RGGGRSSARETAMRVAAGAIAKKYLQQEFGIEVRAYLSQMGEVAIDKVDWNEIENNDFFC
PDVDKVAAFDELIRELKKEGDSIGAKIQVVATGVPVGLGEPVFDRLDADIAHALMSINAV
KGVEIGDGFDVVRQKGSQHRDPLTPQGFRSNHSGGILGGISSGQDIVANIALKPTSSITV
PGETIDVNGEPTELITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRHRGQNQGVVTTTPK
I