Protein Info for CSW01_10455 in Vibrio cholerae E7946 ATCC 55056

Annotation: citrate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01798: citrate (Si)-synthase
  • amino acids 15 to 422 (408 residues), 792.6 bits, E=3.4e-243
• PF00285: Citrate_synt
  • amino acids 47 to 411 (365 residues), 484.3 bits, E=1.1e-149

Best Hits

Swiss-Prot: 78% identical to CISY_ECOL6: Citrate synthase (gltA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01647, citrate synthase [EC: 2.3.3.1] (inferred from 100% identity to vco:VC0395_A1678)

MetaCyc: 78% identical to citrate synthase (Escherichia coli K-12 substr. MG1655)
Citrate (Si)-synthase. [EC: 2.3.3.1, 2.3.3.16, 2.3.3.3]

Predicted SEED Role

"Citrate synthase (si) (EC 2.3.3.1)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 2.3.3.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• mixed acid fermentation (15/16 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle III (animals) (8/10 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• nitrogen remobilization from senescing leaves (5/8 steps found)
• TCA cycle VII (acetate-producers) (5/9 steps found)
• methylaspartate cycle (9/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.1 or 2.3.3.16 or 2.3.3.3

Protein Sequence (429 amino acids)

>CSW01_10455 citrate synthase (Vibrio cholerae E7946 ATCC 55056)
MADKKATLHIEGKAPIELPIMDGSLGPQVIDVRTLGSNGYFTFDPGFLATASCESQITYI
DGAKGILLHRGYPIDQLANNADYLEVCYILLYGEAPNRKQYEEFKKIVTRHTMVHEQIAS
FFHGFRRDAHPMAVMCGVVGALAAFYHDSLDINNDTHREIAAYRLLSKMPTLAAMCYKYS
VGQPFIYPRNDLSYAENFLHMMFATPCEEYEVNPIVARAMDKIFTLHADHEQNASTSTVR
LAGSSGANPFACIAAGIASLWGPAHGGANEACLRMLEEIGSVDKIPEYVRRAKDKDDPFR
LMGFGHRVYKNYDPRATVMREACHEVLKELSIQDPLLDVAMELERIALSDEYFIEKKLYP
NVDFYSGIILKAIGIPVSMFTVIFAMSRTIGWIAHWNEMHSDPDNRIGRPRQLYTGQKLR
DFTPLHERS