Protein Info for CSW01_10340 in Vibrio cholerae E7946 ATCC 55056

Annotation: MinD/ParA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF10609: ParA" amino acids 39 to 279 (241 residues), 72.5 bits, see alignment E=1.2e-23 PF13614: AAA_31" amino acids 40 to 199 (160 residues), 66.2 bits, see alignment E=1.1e-21 PF06564: CBP_BcsQ" amino acids 41 to 280 (240 residues), 30.8 bits, see alignment E=6.3e-11 PF09140: MipZ" amino acids 42 to 222 (181 residues), 34.9 bits, see alignment E=3.1e-12 PF01656: CbiA" amino acids 43 to 258 (216 residues), 59.1 bits, see alignment E=1.4e-19 PF00142: Fer4_NifH" amino acids 48 to 282 (235 residues), 45 bits, see alignment E=3e-15

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 100% identity to vcm:VCM66_1991)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>CSW01_10340 MinD/ParA family protein (Vibrio cholerae E7946 ATCC 55056)
MNLITGPVIQRDSRRRTGMTNKMIYDQASGLRRLTQPSVTKVISVTGGKGGVGKSNVTLG
MAICMAKQGKKVMVLDADLGLANVDVMLGIRPKRNLGHVLAGECELKDAIVEGPHGIRII
PATSGTQSMTELSHAQHVGLIRAFGTLEDEMDILLIDTAAGISDMVVSFSRAAQDVVVVV
CDEPTSITDAYALIKLLSKEHQVQRFKIVANMVRSYREGRELFAKLTLVTERFLNVSLEL
VACIPLDDNVRQAVKRQKIVVDAYPRSPAALAISSLANKALTWPIPRTPSGHLEFFVERL
LNRSETVGEPFGE