Protein Info for CSW01_10275 in Vibrio cholerae E7946 ATCC 55056

Annotation: heme exporter protein CcmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03141: heme exporter protein CcmD
  • amino acids 10 to 56 (47 residues), 55.9 bits, E=1.8e-19
• PF04995: CcmD
  • amino acids 13 to 56 (44 residues), 60 bits, E=9.8e-21

Best Hits

Swiss-Prot: 40% identical to CCMD_SHIFL: Heme exporter protein D (ccmD) from Shigella flexneri

KEGG orthology group: K02196, heme exporter protein D (inferred from 100% identity to vcj:VCD_002312)

MetaCyc: 40% identical to cytochrome c maturation protein D (Escherichia coli K-12 substr. MG1655)
RXN-21407

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmD, interacts with CcmCE" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

• cytochrome c biogenesis (system I type) (6/11 steps found)

Protein Sequence (68 amino acids)

>CSW01_10275 heme exporter protein CcmD (Vibrio cholerae E7946 ATCC 55056)
MHFDSFSDFLAMGGYAAYVWSAFGLTYLSMAMLWIVSVRRKTKLLNQVRDKLARQARIDA
AKHMENTL